{"product_id":"proteintech-13285-1-ap","title":"Proteintech, 13285-1-AP, ZBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBP1 (13285-1-AP) by Proteintech is a Polyclonal antibody targeting ZBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n13285-1-AP targets ZBP1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBP1(Z-DNA-binding protein 1), also named as DAI or DLM-1, is a nucleic acid sensor with some isoforms. It has been reported that ZBP1 can sense the viral nucleic acids of viruses and induce the death of infected cells to prevent virus transmission. ZBP1 can be activated and causes necrocytosis without viral infection, which is associated with nuclear Z-form nucleic acids. ZBP1 can be detected 42 kDa, 55 kDa, 68 kDa isoforms (PMID: 37012234, PMID: 9121465).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4119 Product name: Recombinant human ZBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC028218 Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC Predict reactive species\nFull Name: Z-DNA binding protein 1\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 42-68 kDa\nGenBank Accession Number: BC028218\nGene Symbol: ZBP1\nGene ID (NCBI): 81030\nRRID: AB_2122651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H171\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880752809,"sku":"13285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13285-1-ap","provider":"Iright","version":"1.0","type":"link"}