{"product_id":"proteintech-13335-1-ap","title":"Proteintech, 13335-1-AP, KIR3DL1\/CD158E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIR3DL1\/CD158E (13335-1-AP) by Proteintech is a Polyclonal antibody targeting KIR3DL1\/CD158E in WB, ELISA applications with reactivity to human samples\n13335-1-AP targets KIR3DL1\/CD158E in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKiller cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR3DL1 is a receptor on natural killer (NK) cells for HLA Bw4 allele. It inhibits the activity of NK cells thus preventing cell lysis. KIR3DL1 and KIR3DS1 are highly homologous. This antibody is raised against 22-344 amino acids of human KIR3DL1 and recognizes both KIR3DL1 (49 kDa) and KIR3DS1 (43 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4152 Product name: Recombinant human KIR3DL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-344 aa of BC028206 Sequence: HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIG Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1\nCalculated Molecular Weight: 444 aa, 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC028206\nGene Symbol: KIR3DL1\nGene ID (NCBI): 3811\nRRID: AB_2234189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43629\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869701329065,"sku":"13335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13335-1-ap","provider":"Iright","version":"1.0","type":"link"}