{"product_id":"proteintech-13338-1-ap","title":"Proteintech, 13338-1-AP, ICOS\/CD278 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ICOS\/CD278 (13338-1-AP) by Proteintech is a Polyclonal antibody targeting ICOS\/CD278 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n13338-1-AP targets ICOS\/CD278 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HL-60 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13. Catalog#13338-1-AP recognizes two bands of 25-30 kDa and 45-50 kDa, and the additional 45-50 kDa band may be due to  surface\ndisulfide-linked homodimeric glycoprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4155 Product name: Recombinant human ICOS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC028210 Sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFW Predict reactive species\nFull Name: inducible T-cell co-stimulator\nCalculated Molecular Weight: 199 aa, 23 kDa\nObserved Molecular Weight: 28 kDa, 45-50 kDa\nGenBank Accession Number: BC028210\nGene Symbol: ICOS\nGene ID (NCBI): 29851\nRRID: AB_2122590\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6W8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887675232425,"sku":"13338-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13338-1-ap","provider":"Iright","version":"1.0","type":"link"}