{"product_id":"proteintech-13365-1-ap","title":"Proteintech, 13365-1-AP, NAT10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NAT10 (13365-1-AP) by Proteintech is a Polyclonal antibody targeting NAT10 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n13365-1-AP targets NAT10 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Calu-1 cells,  HEK-293 cells,  NIH\/3T3 cells\nPositive IP detected in: HEK-293 cells, mouse testis tissue\nPositive IHC detected in: human ovary cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. NAT10 is the first enzyme to be found to catalyze ac4C production in eukaryotic RNA and has acetyltransferase activity and RNA-binding activity. (PMID: 23592795). NAT10 is the singular human enzyme to have both acetyltransferase and RNA binding activities (PMID: 30449621). NAT10 is associated with U3 small nucleolar RNA and acetylates upstream binding factors to activate rRNA transcription (PMID: 21177859). NAT10 promoted cisplatin chemoresistance in bladder cancer cells by enhancing DNA damage repair (DDR) (PMID: 36939377). NAT10 is a vital member of the Gcn5-related N-acetyltransferase (GNAT) family and contains 1,025 amino acids with a molecular weight of 116 kDa (PMID: 37128278). NAT10 is commonly expressed in lymphoid tissue, kidney, liver, cerebellum, cerebral cortex, and the central nervous system during the embryonic period. Normal tissue cells express NAT10 in the nucleus, while tumor cells translocate NAT10 to the cytoplasm, nucleoplasm, and nuclear membrane, affecting tumor formation (PMID: 37128278).\nThe specificity of this antibody has been tested by siRNA. (24786082)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, canine, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4184 Product name: Recombinant human NAT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK Predict reactive species\nFull Name: N-acetyltransferase 10 (GCN5-related)\nCalculated Molecular Weight: 1025 aa, 116 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC035558\nGene Symbol: NAT10\nGene ID (NCBI): 55226\nRRID: AB_2148944\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0A0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832551081,"sku":"13365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13365-1-ap","provider":"Iright","version":"1.0","type":"link"}