{"product_id":"proteintech-13369-1-ap","title":"Proteintech, 13369-1-AP, MYNN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYNN (13369-1-AP) by Proteintech is a Polyclonal antibody targeting MYNN in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n13369-1-AP targets MYNN in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Caco-2 cells,  mouse brain tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyoneurin (MYNN) gene locates on 3q26.2 and encodes a member of the BTB\/POZ and zinc finger (ZF) domain-containing protein family that is involved in the control of gene expression. MYNN is widely expressed in various tissue types in mammals. MYNN has 4 isoforms with the molecular mass of 10, 57, 65-69 kDa. (PMID: 30120764)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4188 Product name: Recombinant human MYNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-610 aa of BC033620 Sequence: MCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY Predict reactive species\nFull Name: myoneurin\nCalculated Molecular Weight: 610 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC033620\nGene Symbol: MYNN\nGene ID (NCBI): 55892\nRRID: AB_2923559\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887730610345,"sku":"13369-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13369-1-ap","provider":"Iright","version":"1.0","type":"link"}