{"product_id":"proteintech-13373-1-ap","title":"Proteintech, 13373-1-AP, LYNX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYNX1 (13373-1-AP) by Proteintech is a Polyclonal antibody targeting LYNX1 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n13373-1-AP targets LYNX1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human oesophagus cancer tissue, mouse brain tissue,  human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYNX1, also named as SLURP2,  is a neuronal membrane molecule related to snake a-neurotoxins able to modulate nicotinic acetylcholine receptors (nAChRs). It acts in different tissues through interaction to nAChRs to balance neuronal activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4195 Product name: Recombinant human LYNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-131 aa of BC032306 Sequence: LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD Predict reactive species\nFull Name: Ly6\/neurotoxin 1\nCalculated Molecular Weight: 131 aa, 14 kDa\nGenBank Accession Number: BC032306\nGene Symbol: LYNX1\nGene ID (NCBI): 66004\nRRID: AB_2877944\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZG9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709999273,"sku":"13373-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13373-1-ap","provider":"Iright","version":"1.0","type":"link"}