{"product_id":"proteintech-13394-1-ap","title":"Proteintech, 13394-1-AP, CLEC1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC1A (13394-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC1A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13394-1-AP targets CLEC1A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse thymus tissue,  rat lung tissue\nPositive IHC detected in: mouse lung tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC1A (C-type lectin domain family 1 member A) is a single-pass type II membrane protein that contains one C-type lectin domain. Members of the C-type lectin domain family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC1A is expressed preferentially in dendritic cells and plays a role in regulating dendritic cell function (PMID: 10671229).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4058 Product name: Recombinant human CLEC1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-280 aa of BC039072 Sequence: QYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD Predict reactive species\nFull Name: C-type lectin domain family 1, member A\nCalculated Molecular Weight: 280 aa, 32 kDa\nObserved Molecular Weight: 50 kDa, 32 kDa\nGenBank Accession Number: BC039072\nGene Symbol: CLEC1A\nGene ID (NCBI): 51267\nRRID: AB_2083443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NC01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525430441,"sku":"13394-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13394-1-ap","provider":"Iright","version":"1.0","type":"link"}