{"product_id":"proteintech-13397-1-ap","title":"Proteintech, 13397-1-AP, CCL19\/MIP-3 beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL19\/MIP-3 beta (13397-1-AP) by Proteintech is a Polyclonal antibody targeting CCL19\/MIP-3 beta in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n13397-1-AP targets CCL19\/MIP-3 beta in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4200 Product name: Recombinant human MIP­3β protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC027968 Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Predict reactive species\nFull Name: chemokine (C-C motif) ligand 19\nCalculated Molecular Weight: 98 aa, 12 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC027968\nGene Symbol: CCL19\/MIP-3 beta\nGene ID (NCBI): 6363\nRRID: AB_2071529\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939309225,"sku":"13397-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13397-1-ap","provider":"Iright","version":"1.0","type":"link"}