{"product_id":"proteintech-13430-1-ap","title":"Proteintech, 13430-1-AP, NDUFV3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFV3 (13430-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFV3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n13430-1-AP targets NDUFV3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  human heart tissue,  human liver tissue\nPositive IHC detected in: human placenta tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFV3(NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial) is also named as CI-9kD,Renal carcinoma antigen NY-REN-4 and belongs to the complex I NDUFV3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4234 Product name: Recombinant human NDUFV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC033766 Sequence: MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa\nCalculated Molecular Weight: 108 aa, 12 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC033766\nGene Symbol: NDUFV3\nGene ID (NCBI): 4731\nRRID: AB_2282462\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005598889,"sku":"13430-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13430-1-ap","provider":"Iright","version":"1.0","type":"link"}