{"product_id":"proteintech-13501-1-ap","title":"Proteintech, 13501-1-AP, GPX7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPX7 (13501-1-AP) by Proteintech is a Polyclonal antibody targeting GPX7 in WB, IHC, ELISA applications with reactivity to human samples\n13501-1-AP targets GPX7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue, human placenta tissue,  human brain tissue,  Transfected HEK-293 cells\nPositive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX7(Glutathione peroxidase 7) is also named as CL683,GSHPx-7 and belongs to the glutathione peroxidase family.It shares approximately 45% amino acid sequence with other GPX family members.Because GPX7 expression protected cells from acidic bile acidinduced DNA damage, it may protect oesophageal epithelial cells from acidic bile acid-induced apoptosis(PMID:22157330). This antibody can ve detected as 18-21kDa due to signal peptide splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4328 Product name: Recombinant human GPX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-187 aa of BC032788 Sequence: GFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL Predict reactive species\nFull Name: glutathione peroxidase 7\nCalculated Molecular Weight: 187 aa, 21 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC032788\nGene Symbol: GPX7\nGene ID (NCBI): 2882\nRRID: AB_2112560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96SL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893728937,"sku":"13501-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13501-1-ap","provider":"Iright","version":"1.0","type":"link"}