{"product_id":"proteintech-13517-1-ap","title":"Proteintech, 13517-1-AP, SPARCL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPARCL1 (13517-1-AP) by Proteintech is a Polyclonal antibody targeting SPARCL1 in WB, IP, IHC, ELISA applications with reactivity to human samples\n13517-1-AP targets SPARCL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue\nPositive IP detected in: Raji cells\nPositive IHC detected in: human tonsillitis tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPARC-like protein 1 (SPARCL1), also known as SC1 or Hevin, is an extracellular matrix glycoprotein that belongs to the SPARC family. SPARCL1 is widely expressed in normal and cancer tissues, and has been shown to regulate cellular adhesion and migration. SPARCL1 has been implicated in tumor initiation, formation, and progression of various cancers, including pancreatic, prostate, bladder, ovarian, breast and non-small cell lung cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4448 Product name: Recombinant human SPARCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-664 aa of BC033721 Sequence: VSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDDYFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETSSEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF Predict reactive species\nFull Name: SPARC-like 1 (hevin)\nCalculated Molecular Weight: 664 aa, 75 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC033721\nGene Symbol: SPARCL1\nGene ID (NCBI): 8404\nRRID: AB_10598475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14515\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937113769,"sku":"13517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13517-1-ap","provider":"Iright","version":"1.0","type":"link"}