{"product_id":"proteintech-13594-1-ap","title":"Proteintech, 13594-1-AP, SLC22A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A2 (13594-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n13594-1-AP targets SLC22A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC22A2, also named as OCT2, belongs to the major facilitator (TC 2.A.1) superfamily and Organic cation transporter (TC 2.A.1.19) family. The SLC22A2 gene encodes for the organic cation transporter 2 (OCT2) protein which acts as a renal uptake transporter. Human OCT2 (hOCT2) is expressed on the basolateral side of the proximal tubule cells and plays a crucial role in the disposition and renal clearance of cationic drugs and endogenous compounds (PMID: 35143948). SLC22A2 has 3 isoforms with the molecular mass of 27, 54 and 63 kDa. Sometimes higher molecular weight around 70 kDa can also be observed, which may be a modified variant of SLC22A2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4500 Product name: Recombinant human SLC22A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-150 aa of BC039899 Sequence: GIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLD Predict reactive species\nFull Name: solute carrier family 22 (organic cation transporter), member 2\nCalculated Molecular Weight: 555 aa, 63 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC039899\nGene Symbol: SLC22A2\nGene ID (NCBI): 6582\nRRID: AB_2239467\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15244\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869499642025,"sku":"13594-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13594-1-ap","provider":"Iright","version":"1.0","type":"link"}