{"product_id":"proteintech-13606-1-ap","title":"Proteintech, 13606-1-AP, FBXO22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO22 (13606-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO22 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n13606-1-AP targets FBXO22 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  Jurkat cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO22, also named as FBX22, is a substrate-recognition of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. FBXO22 is a key regulator of senescence induction through ubiquitylation of p53 for degradation. FBXO22 also acts as a molecular switch for the antagonistic and agonistic actions of selective estrogen receptor modulators (SERM) and determines the sensitivity of breast cancer to SERM by ubiquitylating KDM4B complexed with unliganded or SERMs‐bound estrogen receptor (ER). (PMID: 32536008, PMID: 32249768)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4485 Product name: Recombinant human FBXO22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC039024 Sequence: MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK Predict reactive species\nFull Name: F-box protein 22\nCalculated Molecular Weight: 403 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC039024\nGene Symbol: FBXO22\nGene ID (NCBI): 26263\nRRID: AB_2104403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEZ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858929321,"sku":"13606-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13606-1-ap","provider":"Iright","version":"1.0","type":"link"}