{"product_id":"proteintech-13629-1-ap","title":"Proteintech, 13629-1-AP, RALA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RALA (13629-1-AP) by Proteintech is a Polyclonal antibody targeting RALA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13629-1-AP targets RALA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue,  fetal human brain tissue,  MCF-7 cells,  HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRALA belongs to the small GTPase superfamily. Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. RALA plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. As an effector of the proto-oncogene Ras, it play an important role in the molecular pathology of human malignancies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4547 Product name: Recombinant human RALA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC039858 Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Predict reactive species\nFull Name: v-ral simian leukemia viral oncogene homolog A (ras related)\nCalculated Molecular Weight: 206 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC039858\nGene Symbol: RALA\nGene ID (NCBI): 5898\nRRID: AB_2269251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868929675433,"sku":"13629-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13629-1-ap","provider":"Iright","version":"1.0","type":"link"}