{"product_id":"proteintech-13630-1-ap","title":"Proteintech, 13630-1-AP, CREB3L4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CREB3L4 (13630-1-AP) by Proteintech is a Polyclonal antibody targeting CREB3L4 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n13630-1-AP targets CREB3L4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HL-60 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCREB3L4 (cAMP responsive element binding protein 3-like 4), also named as AIBZIP, CREB4 and ATCE1, is a member of the CREB\/ATF transcription factor family. CREB3L4 may play a role in the unfolded protein response, characterized by their regulation of gene expression through the cAMP-responsive element(PMID: 22829733). CREB3L4 is highly expressed in multiple human cancers, such as human breast carcinoma, prostate cancer(PMID: 32026099, PMID: 28338058). The molecular weight of CREB3L4 is 43 kDa and 55 kDa precursor was reported. Due to glycosylation, CREB3L4 can be observed with molecular weights of 35 and 41 kDa (PMID: 25412305, 15938716).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4548 Product name: Recombinant human CREB3L4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC038962 Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAG Predict reactive species\nFull Name: cAMP responsive element binding protein 3-like 4\nCalculated Molecular Weight: 395 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC038962\nGene Symbol: CREB3L4\nGene ID (NCBI): 148327\nRRID: AB_2276550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEY5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869662335145,"sku":"13630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13630-1-ap","provider":"Iright","version":"1.0","type":"link"}