{"product_id":"proteintech-13669-1-ap","title":"Proteintech, 13669-1-AP, PEX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEX1 (13669-1-AP) by Proteintech is a Polyclonal antibody targeting PEX1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13669-1-AP targets PEX1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells\nPositive IHC detected in: human liver cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells,  A431 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxin (PEX) proteins generate and maintain peroxisomes. The peroxin-1 (PEX1) ATPase facilitates the recycling of the peroxisome matrix protein receptor PEX5 and is the most commonly affected peroxin in human peroxisome biogenesis disorders (PMID: 28600347).  PEX1 and PEX6 are the only members of the AAA family (for ATPases associated with diverse cellular) activities implicated in peroxisome biogenesis and are closely related to p97, which functions in endoplasmic reticulum-associated protein degradation to retrotranslocate endoplasmic reticulum proteins to the cytosol (PMID: 9695811; 11740563).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4623 Product name: Recombinant human PEX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 927-1283 aa of BC035575 Sequence: IRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPGQKVTLA Predict reactive species\nFull Name: peroxisomal biogenesis factor 1\nCalculated Molecular Weight: 1283 aa, 143 kDa\nObserved Molecular Weight: 143 kDa\nGenBank Accession Number: BC035575\nGene Symbol: PEX1\nGene ID (NCBI): 5189\nRRID: AB_2162104\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43933\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903264425,"sku":"13669-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13669-1-ap","provider":"Iright","version":"1.0","type":"link"}