{"product_id":"proteintech-13681-1-ap","title":"Proteintech, 13681-1-AP, TFF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFF2 (13681-1-AP) by Proteintech is a Polyclonal antibody targeting TFF2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n13681-1-AP targets TFF2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human stomach tissue, human urine sample\nPositive IP detected in: mouse stomach tissue\nPositive IHC detected in: human stomach tissue, human stomach cancer tissue,  mouse stomach tissue,  mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa),  secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting  maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, hamster, gerbil\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species\nFull Name: trefoil factor 2\nCalculated Molecular Weight: 129 aa, 14 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC032820\nGene Symbol: TFF2\nGene ID (NCBI): 7032\nRRID: AB_10598321\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03403\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868846837929,"sku":"13681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13681-1-ap","provider":"Iright","version":"1.0","type":"link"}