{"product_id":"proteintech-13698-1-ap","title":"Proteintech, 13698-1-AP, IRF2BP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF2BP1 (13698-1-AP) by Proteintech is a Polyclonal antibody targeting IRF2BP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13698-1-AP targets IRF2BP1 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  Jurkat cells,  mouse brain tissue,  rat lymph tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF2BP1 inhibits IRF2-mediated transcriptional activation by interacting with IRF2. In epidermal growth factor receptor (EGFR) signaling, transient deSUMOylation of IRF2BP1 is essential for the proper expression of immediate early genes such as DUSP1 and ATF3. IRF2BP1 is also involved in the TGF-β signaling pathway by controlling the accumulation of cPML in the cytoplasm, which in turn affects the phosphorylation of Smad2 and the assembly of the Smad2-receptor complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4596 Product name: Recombinant human IRF2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-584 aa of BC038222 Sequence: LALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVPSPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP Predict reactive species\nFull Name: interferon regulatory factor 2 binding protein 1\nCalculated Molecular Weight: 584 aa, 62 kDa\nObserved Molecular Weight: 62-72 kDa\nGenBank Accession Number: BC038222\nGene Symbol: IRF2BP1\nGene ID (NCBI): 26145\nRRID: AB_2126853\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IU81\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869552201897,"sku":"13698-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13698-1-ap","provider":"Iright","version":"1.0","type":"link"}