{"product_id":"proteintech-13712-1-ap","title":"Proteintech, 13712-1-AP, PNCK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PNCK (13712-1-AP) by Proteintech is a Polyclonal antibody targeting PNCK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13712-1-AP targets PNCK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:9000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4650 Product name: Recombinant human PNCK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC033746 Sequence: MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL Predict reactive species\nFull Name: pregnancy up-regulated non-ubiquitously expressed CaM kinase\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 38 kDa, 45 kDa\nGenBank Accession Number: BC033746\nGene Symbol: PNCK\nGene ID (NCBI): 139728\nRRID: AB_10642952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P2M8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766950057,"sku":"13712-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13712-1-ap","provider":"Iright","version":"1.0","type":"link"}