{"product_id":"proteintech-13715-1-ap","title":"Proteintech, 13715-1-AP, LSS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSS (13715-1-AP) by Proteintech is a Polyclonal antibody targeting LSS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13715-1-AP targets LSS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1376 cells, PC-3 cells,  HeLa cells,  HepG2 cells,  mouse testis tissue,  human brain tissue,  mouse pancreas tissue,  mouse liver tissue,  SH-SY5Y cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLSS, also named as OSC, is lanosterol synthase which catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus. LSS gene has three isoforms with MW 74 kDa and 82-85 kDa. This antibody can recognize all these three isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4655 Product name: Recombinant human LSS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-732 aa of BC035638 Sequence: NGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP Predict reactive species\nFull Name: lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)\nCalculated Molecular Weight: 732 aa, 83 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC035638\nGene Symbol: LSS\nGene ID (NCBI): 4047\nRRID: AB_10597096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48449\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869578921,"sku":"13715-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13715-1-ap","provider":"Iright","version":"1.0","type":"link"}