{"product_id":"proteintech-13720-1-ap","title":"Proteintech, 13720-1-AP, BOULE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BOULE (13720-1-AP) by Proteintech is a Polyclonal antibody targeting BOULE in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n13720-1-AP targets BOULE in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF-Fro detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBOULE, also called BOLL, belongs to the RRM DAZ family. BOULE has been identified as being involved in regulating the development and differentiation of germ cells and playing an essential role in infertility (PMID: 31683986). BOULE is specifically expressed in testis, but not in early embryos, primordial germ cells, and spermatogonial cells. It is first expressed in the cytoplasm of spermatocytes and then persists through meiosis. BOULE has 5 isoforms with the molecular mass of 19 and 31-38 kDa. This antibody detects two bands in testis, the lower band of ~40 kDa in size corresponds to the predicted endogenous BOULE protein, while the upper band may be an isoform or posttranslationally modified version of the BOULE protein (PMID: 27632217).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4662 Product name: Recombinant human BOLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC033674 Sequence: MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY Predict reactive species\nFull Name: bol, boule-like (Drosophila)\nCalculated Molecular Weight: 283 aa, 31 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC033674\nGene Symbol: BOULE\nGene ID (NCBI): 66037\nRRID: AB_2290617\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N9W6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869643657385,"sku":"13720-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13720-1-ap","provider":"Iright","version":"1.0","type":"link"}