{"product_id":"proteintech-13722-1-ap","title":"Proteintech, 13722-1-AP, TTF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTF2 (13722-1-AP) by Proteintech is a Polyclonal antibody targeting TTF2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13722-1-AP targets TTF2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HeLa cells,  Jurkat cells\nPositive IP detected in: A2780 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscription elongation is an key target for control of eukaryotic gene expression. After initiating from a promoter, the RNA polymerase II elongation complex is subjected to a block to elongation by the action of components of N-TEF (negative transcription elongation factor) [PMID: 9748214].  Transcription termination factor 2 (TTF2) is a DsDNA-dependent ATPase that acts as a transcription termination factor by coupling ATP hydrolysis with removal of RNA polymerase II from the DNA template. It also contribute to mitotic transcription repression, and involved in pre-mRNA splicing[PMID:15125840, 12927788].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4671 Product name: Recombinant human TTF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC030058 Sequence: MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSSGLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKSSGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGPLNKEYTNWEAKETKAKDGPS Predict reactive species\nFull Name: transcription termination factor, RNA polymerase II\nCalculated Molecular Weight: 1162 aa, 129 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC030058\nGene Symbol: TTF2\nGene ID (NCBI): 8458\nRRID: AB_2262865\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869506490537,"sku":"13722-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13722-1-ap","provider":"Iright","version":"1.0","type":"link"}