{"product_id":"proteintech-13741-1-ap","title":"Proteintech, 13741-1-AP, TPM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPM4 (13741-1-AP) by Proteintech is a Polyclonal antibody targeting TPM4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13741-1-AP targets TPM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, HeLa cells,  rat skeletal muscle tissue\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPM4, also named as TM30p1, Tropomyosin 4, Tropomyosin alpha 4 chain. This gene is one gene type of tropomyosin isoforms and encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is a major regulatory protein of cytoskeleton and is localized along actin filaments modulating the interaction of actin and myosin (PubMed: 26315888, PubMed: 32638329). In addition, TPM4 has been reported as an oncoprotein in several malignancies (PubMed: 37459535). The calculated molecular weight of TPM4 is usually approximately 28 kDa. It maybe have two isoforms: the short 30-kDa isoform (TPM4.2) and the long 38-kDa isoform (TPM4.1) (PubMed: 28134622).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4679 Product name: Recombinant human TPM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species\nFull Name: tropomyosin 4\nCalculated Molecular Weight: 248 aa, 29 kDa\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: BC037576\nGene Symbol: TPM4\nGene ID (NCBI): 7171\nENSEMBL Gene ID: ENSG00000167460\nRRID: AB_2205772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P67936\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388263593,"sku":"13741-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13741-1-ap","provider":"Iright","version":"1.0","type":"link"}