{"product_id":"proteintech-13747-1-ap","title":"Proteintech, 13747-1-AP, GADD45A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GADD45A (13747-1-AP) by Proteintech is a Polyclonal antibody targeting GADD45A in WB, ELISA applications with reactivity to human samples\n13747-1-AP targets GADD45A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGADD45A, also named as DDIT1 and GADD45, belongs to the GADD45 family. It binds to proliferating cell nuclear antigen. GADD45A may affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. GADD45A plays an essential role in active DNA demethylation during terminal osteogenic differentiation of adipose-derived mesenchymal stem cells. GADD45A has Dimer (~28-36 kDa) and Monomer (14-18 kDa) forms (PMID:11498536).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4687 Product name: Recombinant human GADD45A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-165 aa of BC011757 Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Predict reactive species\nFull Name: growth arrest and DNA-damage-inducible, alpha\nCalculated Molecular Weight: 165 aa, 18 kDa\nObserved Molecular Weight: 18 kDa, 33 kDa\nGenBank Accession Number: BC011757\nGene Symbol: GADD45A\nGene ID (NCBI): 1647\nRRID: AB_2108058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24522\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876460201,"sku":"13747-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13747-1-ap","provider":"Iright","version":"1.0","type":"link"}