{"product_id":"proteintech-13763-1-ap","title":"Proteintech, 13763-1-AP, PFKFB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFKFB3 (13763-1-AP) by Proteintech is a Polyclonal antibody targeting PFKFB3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n13763-1-AP targets PFKFB3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse thymus tissue,  mouse heart tissue,  A431 cells,  HeLa cells,  Jurkat cells,  mouse spleen tissue\nPositive IP detected in: mouse spleen tissue\nPositive IHC detected in: human stomach cancer tissue, human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4744 Product name: Recombinant human PFKFB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-520 aa of BC040482 Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH Predict reactive species\nFull Name: 6-phosphofructo-2-kinase\/fructose-2,6-biphosphatase 3\nCalculated Molecular Weight: 520 aa, 60 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC040482\nGene Symbol: PFKFB3\nGene ID (NCBI): 5209\nRRID: AB_2162854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868825637033,"sku":"13763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13763-1-ap","provider":"Iright","version":"1.0","type":"link"}