{"product_id":"proteintech-13770-1-ap","title":"Proteintech, 13770-1-AP, TRAK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAK2 (13770-1-AP) by Proteintech is a Polyclonal antibody targeting TRAK2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13770-1-AP targets TRAK2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4753 Product name: Recombinant human TRAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC040668 Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS Predict reactive species\nFull Name: trafficking protein, kinesin binding 2\nCalculated Molecular Weight: 914 aa, 101 kDa\nObserved Molecular Weight: 101-106 kDa\nGenBank Accession Number: BC040668\nGene Symbol: TRAK2\nGene ID (NCBI): 66008\nRRID: AB_2207961\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990623913,"sku":"13770-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13770-1-ap","provider":"Iright","version":"1.0","type":"link"}