{"product_id":"proteintech-13774-1-ap","title":"Proteintech, 13774-1-AP, PCP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCP2 (13774-1-AP) by Proteintech is a Polyclonal antibody targeting PCP2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n13774-1-AP targets PCP2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissue, mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPcp2 is uniquely expressed in cerebellar Purkinje cells and in retinal bipolar neurons, and it may function as a cell-type specific modulator for G protein-mediated cell signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4759 Product name: Recombinant human PCP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC038715 Sequence: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP Predict reactive species\nFull Name: Purkinje cell protein 2\nCalculated Molecular Weight: 136 aa, 15 kDa\nGenBank Accession Number: BC038715\nGene Symbol: PCP2\nGene ID (NCBI): 126006\nRRID: AB_2935435\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887754006697,"sku":"13774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13774-1-ap","provider":"Iright","version":"1.0","type":"link"}