{"product_id":"proteintech-13778-1-ap","title":"Proteintech, 13778-1-AP, TSLP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nTSLP Polyclonal Antibody for IHC, ELISA\n13778-1-AP targets TSLP in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue, human testis tissue,  human spleen tissue,  human lung tissue,  human ovary tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4771 Product name: Recombinant human TSLP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-159 aa of BC016720 Sequence: IQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species\nFull Name: thymic stromal lymphopoietin\nCalculated Molecular Weight: 15 kDa, 42 kDa\nGenBank Accession Number: BC016720\nGene Symbol: TSLP\nGene ID (NCBI): 85480\nRRID: AB_2208528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969D9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909195433,"sku":"13778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13778-1-ap","provider":"Iright","version":"1.0","type":"link"}