{"product_id":"proteintech-13790-1-ap","title":"Proteintech, 13790-1-AP, Radixin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Radixin (13790-1-AP) by Proteintech is a Polyclonal antibody targeting Radixin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13790-1-AP targets Radixin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse pancreas tissue,  Y79 cells,  rat pancreas tissue\nPositive IHC detected in: human pancreas cancer tissue,  human liver cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRadixin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to chemokine and antigen stimulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4813 Product name: Recombinant human RDX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC047109 Sequence: MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIE Predict reactive species\nFull Name: radixin\nCalculated Molecular Weight: 583 aa, 68 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC047109\nGene Symbol: RDX\nGene ID (NCBI): 5962\nRRID: AB_2300889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869492826281,"sku":"13790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13790-1-ap","provider":"Iright","version":"1.0","type":"link"}