{"product_id":"proteintech-13831-1-ap","title":"Proteintech, 13831-1-AP, GLRA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLRA2 (13831-1-AP) by Proteintech is a Polyclonal antibody targeting GLRA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13831-1-AP targets GLRA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PBMC cells, K-562 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4743 Product name: Recombinant human GLRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC032864 Sequence: MNRQLVNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMG Predict reactive species\nFull Name: glycine receptor, alpha 2\nCalculated Molecular Weight: 452 aa, 52 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC032864\nGene Symbol: GLRA2\nGene ID (NCBI): 2742\nRRID: AB_2877980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23416\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887652163753,"sku":"13831-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13831-1-ap","provider":"Iright","version":"1.0","type":"link"}