{"product_id":"proteintech-13858-1-ap","title":"Proteintech, 13858-1-AP, EP400 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EP400 (13858-1-AP) by Proteintech is a Polyclonal antibody targeting EP400 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n13858-1-AP targets EP400 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE1A binding protein p400 (EP400) is a SWR1-class ATP-dependent chromatin remodeling protein originally identified as an interacting partner for the adenovirus E1A protein required for viral replication and cellular transformation. EP400 plays a crucial role in promoting double-strand break (DSB) repair through homologous recombination (PMID: 26669263, 37922899). Depletion of Ep400 in oocytes led to accumulated DSBs, causing abnormal aggregation and dysfunction of cytoplasmic organelles, resulting in impaired oocyte development and declined oocyte quality (PMID: 38493496).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4832 Product name: Recombinant human EP400 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC037208 Sequence: MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQLMNRSPATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGV Predict reactive species\nFull Name: E1A binding protein p400\nCalculated Molecular Weight: 3160 aa, 344 kDa\nObserved Molecular Weight: 344 kDa\nGenBank Accession Number: BC037208\nGene Symbol: EP400\nGene ID (NCBI): 57634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96L91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887576240297,"sku":"13858-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13858-1-ap","provider":"Iright","version":"1.0","type":"link"}