{"product_id":"proteintech-13859-1-ap","title":"Proteintech, 13859-1-AP, TIMM44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIMM44 (13859-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM44 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13859-1-AP targets TIMM44 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Neuro-2a cells,  C6 cells,  Jurkat cells\nPositive IP detected in: HeLa cells, mouse heart tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranslocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4834 Product name: Recombinant human TIMM44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 153-452 aa of BC033628 Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 44 homolog (yeast)\nCalculated Molecular Weight: 452 aa, 51 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC033628\nGene Symbol: TIMM44\nGene ID (NCBI): 10469\nRRID: AB_2204679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43615\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858536105,"sku":"13859-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13859-1-ap","provider":"Iright","version":"1.0","type":"link"}