{"product_id":"proteintech-13891-1-ap","title":"Proteintech, 13891-1-AP, NDUFAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFAF2 (13891-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFAF2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n13891-1-AP targets NDUFAF2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMimitin, also named as MMTN, B17.2L, NDUFAF2 and NDUFA12L, is a small mitochondrial protein upregulated by proinflammatory cytokines at the transcriptional and protein levels. It is reported as a possible chaperone for assembly of mitochondrial complex I. The MW of Mimitin is 17-25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4853 Product name: Recombinant human NDUFAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC033965 Sequence: MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2\nCalculated Molecular Weight: 169 aa, 20 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC033965\nGene Symbol: NDUFAF2\nGene ID (NCBI): 91942\nRRID: AB_10597105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N183\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869476343977,"sku":"13891-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13891-1-ap","provider":"Iright","version":"1.0","type":"link"}