{"product_id":"proteintech-13914-1-ap","title":"Proteintech, 13914-1-AP, SNN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNN (13914-1-AP) by Proteintech is a Polyclonal antibody targeting SNN in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13914-1-AP targets SNN in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStannin (Snn) is discovered using subtractive hybridization methodology designed to find gene products related to selective organotin toxicity and apoptosis. It is present in TMT-sensitive cells and may play a role in the selective toxicity of organotin compounds.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4909 Product name: Recombinant human SNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC036443 Sequence: MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG Predict reactive species\nFull Name: stannin\nCalculated Molecular Weight: 9 kDa\nGenBank Accession Number: BC036443\nGene Symbol: SNN\nGene ID (NCBI): 8303\nRRID: AB_2918033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75324\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810662569,"sku":"13914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13914-1-ap","provider":"Iright","version":"1.0","type":"link"}