{"product_id":"proteintech-13931-1-ap","title":"Proteintech, 13931-1-AP, Carbonic Anhydrase 4\/CA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Carbonic Anhydrase 4\/CA4 (13931-1-AP) by Proteintech is a Polyclonal antibody targeting Carbonic Anhydrase 4\/CA4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13931-1-AP targets Carbonic Anhydrase 4\/CA4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressing on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4960 Product name: Recombinant human CA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-284 aa of BC057792 Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS Predict reactive species\nFull Name: carbonic anhydrase IV\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC057792\nGene Symbol: CA4\nGene ID (NCBI): 762\nRRID: AB_2877990\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22748\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993900713,"sku":"13931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13931-1-ap","provider":"Iright","version":"1.0","type":"link"}