{"product_id":"proteintech-13947-1-ap","title":"Proteintech, 13947-1-AP, GPX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPX3 (13947-1-AP) by Proteintech is a Polyclonal antibody targeting GPX3 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n13947-1-AP targets GPX3 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\nPositive IHC detected in: rat eye tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX3 (glutathione peroxidase 3) is also named as Plasma Glutathione Peroxidase. GPX3 can protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPX3 is secreted into plasma and like GPX1, is an 100 kDa homotetramer consisting of four identical 23 kDa subunits, each containing a selenocysteine residue at the active site. It can be detected a band of 20 kDa which is considered as the chain A of GPX3 (selenocysteine to glycine mutant).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5054 Product name: Recombinant human GPX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC050378 Sequence: MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY Predict reactive species\nFull Name: glutathione peroxidase 3 (plasma)\nCalculated Molecular Weight: 226 aa, 26 kDa\nObserved Molecular Weight: 20-27 kDa\nGenBank Accession Number: BC050378\nGene Symbol: GPX3\nGene ID (NCBI): 2878\nRRID: AB_3085426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868912373929,"sku":"13947-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13947-1-ap","provider":"Iright","version":"1.0","type":"link"}