{"product_id":"proteintech-13980-1-ap","title":"Proteintech, 13980-1-AP, YAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YAF2 (13980-1-AP) by Proteintech is a Polyclonal antibody targeting YAF2 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n13980-1-AP targets YAF2 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HeLa cells, Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYY1-associated factor 2 (YAF2)  is the binding molecule of Yin-Yang-1 (YY-1) protein and plays an important role in transcriptional regulation. YAF-2 mRNA expression was the highest in heart and skeletal muscle (PMID: 11953439).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5023 Product name: Recombinant human YAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC037777 Sequence: MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH Predict reactive species\nFull Name: YY1 associated factor 2\nCalculated Molecular Weight: 204 aa, 23 kDa\nObserved Molecular Weight: 20-30 kDa\nGenBank Accession Number: BC037777\nGene Symbol: YAF2\nGene ID (NCBI): 10138\nRRID: AB_3669173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IY57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925448873,"sku":"13980-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13980-1-ap","provider":"Iright","version":"1.0","type":"link"}