{"product_id":"proteintech-13990-1-ap","title":"Proteintech, 13990-1-AP, GRK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRK2 (13990-1-AP) by Proteintech is a Polyclonal antibody targeting GRK2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human samples\n13990-1-AP targets GRK2 in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Jurkat cells\nPositive IP detected in: HL-60 cells\nPositive IHC detected in: human lymphoma tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRK2 (G-protein coupled receptor kinase 2) is also named as ADRBK1 (Beta-adrenergic receptor kinase 1), BARK, and BARK1. G-protein-coupled receptors (GPCRs) transmit extracellular signals across the cell membrane. GPCR kinases (GRKs) desensitize GPCR signals in the cell membrane. GRK2 translocation from the cytoplasm to the cell membrane in response to extracellular signals is critical to the function of the protein, where GRK phosphorylation is an important component of its translocation to the membrane.(PMID:27412951)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5071 Product name: Recombinant human ADRBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 390-689 aa of BC037963 Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL Predict reactive species\nFull Name: adrenergic, beta, receptor kinase 1\nCalculated Molecular Weight: 689 aa, 80 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC037963\nGene Symbol: ADRBK1\nGene ID (NCBI): 156\nRRID: AB_2225833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25098\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906148009,"sku":"13990-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13990-1-ap","provider":"Iright","version":"1.0","type":"link"}