{"product_id":"proteintech-14017-1-ap","title":"Proteintech, 14017-1-AP, ESRRG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESRRG (14017-1-AP) by Proteintech is a Polyclonal antibody targeting ESRRG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14017-1-AP targets ESRRG in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue,  human kidney tissue\nPositive IHC detected in: rat stomach tissue, mouse brain tissue,  mouse heart tissue,  rat brain tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEstrogen-related receptor gamma (ERR-gamma), also known as NR3B3 (nuclear receptor subfamily 3, group B, member 3), is a member of nuclear hormone receptor family of steroid hormone receptors. As an orphan nuclear receptor, it binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. It behaves as a constitutive activator of transcription. 4-hydroxytamoxifen and diethylstilbestrol may act as inverse agonists and deactivate ESRRG. It also seems to be the target of bisphenol A. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ESRRG.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5127 Product name: Recombinant human ESRRG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-442 aa of BC064700 Sequence: EYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV Predict reactive species\nFull Name: estrogen-related receptor gamma\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC064700\nGene Symbol: ESRRG\nGene ID (NCBI): 2104\nRRID: AB_2100272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62508\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980203689,"sku":"14017-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14017-1-ap","provider":"Iright","version":"1.0","type":"link"}