{"product_id":"proteintech-14037-1-ap","title":"Proteintech, 14037-1-AP, FEM1C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FEM1C (14037-1-AP) by Proteintech is a Polyclonal antibody targeting FEM1C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14037-1-AP targets FEM1C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  HepG2 cells,  rat brain tissue\nPositive IHC detected in: human heart tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein fem-1 homolog C (FEM1C) is involved in protein modification and ubiquitination.Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit.Highly expressed in kidney, cardiac tissue, skeletal muscle and testis. Expressed at lower levels in other tissues, including cartilage.This antibody specifically recognizes the 69kd FEM1C protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5099 Product name: Recombinant human FEM1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-617 aa of BC028369 Sequence: PDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHIPEKLETFVSLHR Predict reactive species\nFull Name: fem-1 homolog c (C. elegans)\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC028369\nGene Symbol: FEM1C\nGene ID (NCBI): 56929\nRRID: AB_2878002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638368425,"sku":"14037-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14037-1-ap","provider":"Iright","version":"1.0","type":"link"}