{"product_id":"proteintech-14041-1-ap","title":"Proteintech, 14041-1-AP, DDX3Y Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX3Y (14041-1-AP) by Proteintech is a Polyclonal antibody targeting DDX3Y in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n14041-1-AP targets DDX3Y in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, LNCaP cells,  PC-3 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. DDX3Y is one member of DEAD box RNA helicases, encode by the gene locate on the chromosome Y in the azoospermia factor A region. Polyclonal anti-DDX3Y antibodies (14041-1-AP) are produced by immunizing animals with C-terminus of DDX3Y and detect an 73-kDa band. As DDX3Y has a structural homolog with DDX3X, the antibody can recognize both.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5110 Product name: Recombinant human DDX3Y protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-660 aa of BC034942 Sequence: LERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC034942\nGene Symbol: DDX3Y\nGene ID (NCBI): 8653\nRRID: AB_2092884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15523\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869673214121,"sku":"14041-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14041-1-ap","provider":"Iright","version":"1.0","type":"link"}