{"product_id":"proteintech-14048-1-ap","title":"Proteintech, 14048-1-AP, FATP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FATP2 (14048-1-AP) by Proteintech is a Polyclonal antibody targeting FATP2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14048-1-AP targets FATP2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver,  rat kidney,  rat liver,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFATP2 is a member of the FATP family which functions in lipid and bile metabolism. It is a 70-kDa protein predominantly expressed in liver and kidney. Kidney FATP2 is localized exclusively to proximal tubule epithelial cells along the apical but not the basolateral membrane, and regulates lipoapoptosis. FATP2 is involved in metabolism-related diseases including nonalcoholic fatty liver disease (NAFLD) and type 2 diabetes mellitus (T2DM), and is a potential clinical biomarker and therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5217 Product name: Recombinant human SLC27A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-567 aa of BC057770 Sequence: ESWRSEVTFSTPALYIYTSGTTGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL Predict reactive species\nFull Name: solute carrier family 27 (fatty acid transporter), member 2\nCalculated Molecular Weight: 567 aa, 65 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC057770\nGene Symbol: FATP2\/SLC27A2\nGene ID (NCBI): 11001\nRRID: AB_2239416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14975\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868846411945,"sku":"14048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14048-1-ap","provider":"Iright","version":"1.0","type":"link"}