{"product_id":"proteintech-14060-1-ap","title":"Proteintech, 14060-1-AP, PARK2\/Parkin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PARK2\/Parkin (14060-1-AP) by Proteintech is a Polyclonal antibody targeting PARK2\/Parkin in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n14060-1-AP targets PARK2\/Parkin in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, C6 cells,  HEK-293 cells,  mouse liver tissue,  PC-12 cells,  rat brain tissue,  pig brain tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue, mouse brain tissue\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nParkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing with molecular weights of 24, 31, 36 and 42-52 kDa. Sometimes an additional band of 70 kDa or 110 kDa may be detected, which is caused by ubiquitination modification or formation of Parkin complex (PMID: 10976934, PMID: 18190519).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, rabbit, monkey, chicken, bovine, cattle, ducks\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species\nFull Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 42-52 kDa\nGenBank Accession Number: BC022014\nGene Symbol: Parkin\nGene ID (NCBI): 5071\nRRID: AB_2878005\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60260\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868820099241,"sku":"14060-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14060-1-ap","provider":"Iright","version":"1.0","type":"link"}