{"product_id":"proteintech-14068-1-ap","title":"Proteintech, 14068-1-AP, ARID3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARID3A (14068-1-AP) by Proteintech is a Polyclonal antibody targeting ARID3A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14068-1-AP targets ARID3A in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse placenta tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARID3A is a nuclear matrix-associated transcription factor that stimulates immunoglobulin heavy chain (IgH) expression and Cyclin E1\/E2F-dependent cell cycle progression. It activates IgH transcriptional initiation by binding to ATC-rich P sites within nuclear matrix attachment regions (MARs) flanking the IgH intronic enhancer (Emu) (PMID:17386101). It is the founder of the 13-member (in humans) ARID (AT-Rich Interaction Domain) family, which share a highly conserved DNA binding domain, but functions in diverse biological processes such as cell cycle regulated events, epigenetic post-translational modification, and chromatin remodeling (PMID:15927959,11959810,11283269). The expression molecular weight observed is consistent with what has been described in the literature (PMID: 15922553, 19436740).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5124 Product name: Recombinant human ARID3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-593 aa of BC060828 Sequence: FLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP Predict reactive species\nFull Name: AT rich interactive domain 3A (BRIGHT-like)\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC060828\nGene Symbol: ARID3A\nGene ID (NCBI): 1820\nRRID: AB_2060390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99856\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922695849,"sku":"14068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14068-1-ap","provider":"Iright","version":"1.0","type":"link"}