{"product_id":"proteintech-14078-1-ap","title":"Proteintech, 14078-1-AP, GNL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNL1 (14078-1-AP) by Proteintech is a Polyclonal antibody targeting GNL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n14078-1-AP targets GNL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  Raji cells,  U-937 cells,  K-562 cells,  MCF-7 cells\nPositive IHC detected in: human heart tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanine nucleotide-binding protein-like 1 (GNL1), also known as HSR1, belongs to HSR1_MMR1 subfamily of nucleolar GTPases. It encodes 607 amino acids with a molecular mass of 69 kDa and contains basic amino acids rich N-terminus, acidic amino acids rich C-terminus and proline rich-domains. GNL1 plays a critical role in liver cell proliferation, but its function remains largely unknown (PMID: 18255255).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5203 Product name: Recombinant human GNL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-607 aa of BC018366 Sequence: EKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYALLGEDEC Predict reactive species\nFull Name: guanine nucleotide binding protein-like 1\nCalculated Molecular Weight: 607 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC018366\nGene Symbol: GNL1\nGene ID (NCBI): 2794\nRRID: AB_10641989\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36915\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688254633,"sku":"14078-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14078-1-ap","provider":"Iright","version":"1.0","type":"link"}