{"product_id":"proteintech-14116-1-ap","title":"Proteintech, 14116-1-AP, ASPH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASPH (14116-1-AP) by Proteintech is a Polyclonal antibody targeting ASPH in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14116-1-AP targets ASPH in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A549 cells,  human brain tissue,  rat brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAspartate-β-hydroxylase (ASPH; termed AAH in older literature) has been implicated in the cross-talk among all of these signaling pathways. Correspondingly, ASPH is expressed at high levels in many malignant neoplasms of different histogeneses. It has the 86-141 kDa bands (native and phosphorylated forms), cleavage products of 35-56 and 22-26 kDa.(PMID:27981247\/PMID: 10956665)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5265 Product name: Recombinant human ASPH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC066929 Sequence: MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDDAKVLLGLTKDGSNENIDSLEEVLNILAEESSDWFYGFLSFLYDIMTPFEMLEEEEEESETADGVDGTSQNEGVQGKTCVILDLHNQ Predict reactive species\nFull Name: aspartate beta-hydroxylase\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC066929\nGene Symbol: ASPH\nGene ID (NCBI): 444\nRRID: AB_2060148\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869393539241,"sku":"14116-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14116-1-ap","provider":"Iright","version":"1.0","type":"link"}