{"product_id":"proteintech-14118-1-ap","title":"Proteintech, 14118-1-AP, FLAD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FLAD1 (14118-1-AP) by Proteintech is a Polyclonal antibody targeting FLAD1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14118-1-AP targets FLAD1 in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HEK-293 cells,  HepG2 cells,  rat liver tissue,  L02 cells,  mouse liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5267 Product name: Recombinant human FLAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-447 aa of BC011378 Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG Predict reactive species\nFull Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)\nCalculated Molecular Weight: 446 aa, 49 kDa\nObserved Molecular Weight: 50 kDa, 65-70 kDa\nGenBank Accession Number: BC011378\nGene Symbol: FLAD1\nGene ID (NCBI): 80308\nRRID: AB_2878017\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869461369001,"sku":"14118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14118-1-ap","provider":"Iright","version":"1.0","type":"link"}