{"product_id":"proteintech-14126-1-ap","title":"Proteintech, 14126-1-AP, PRDM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDM5 (14126-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14126-1-AP targets PRDM5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue,  mouse colon tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5277 Product name: Recombinant human PRDM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC066942 Sequence: MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQDKNLGPAEWRG Predict reactive species\nFull Name: PR domain containing 5\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC066942\nGene Symbol: PRDM5\nGene ID (NCBI): 11107\nRRID: AB_2878019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQX1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887772586153,"sku":"14126-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14126-1-ap","provider":"Iright","version":"1.0","type":"link"}