{"product_id":"proteintech-14134-1-ap","title":"Proteintech, 14134-1-AP, Beta ENaC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Beta ENaC (14134-1-AP) by Proteintech is a Polyclonal antibody targeting Beta ENaC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14134-1-AP targets Beta ENaC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  mouse kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCNN1B, also named as SCNEB, ENaCB, Beta-NaCH and Beta-ENaC, belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family and SCNN1B subfamily. Sodium permeable non-voltage-sensitive ion channel is inhibited by the diuretic amiloride. SCNN1B mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. It controls the reabsorption of sodium in kidney, colon, lung and sweat glands. SCNN1B plays a role in taste perception.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5348 Product name: Recombinant human β-ENaC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-401 aa of BC036352 Sequence: GIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNC Predict reactive species\nFull Name: sodium channel, nonvoltage-gated 1, beta\nCalculated Molecular Weight: 640 aa, 73 kDa\nObserved Molecular Weight: 75-80 kDa\nGenBank Accession Number: BC036352\nGene Symbol: Beta ENaC\nGene ID (NCBI): 6338\nRRID: AB_2184378\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51168\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896055465,"sku":"14134-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14134-1-ap","provider":"Iright","version":"1.0","type":"link"}