{"product_id":"proteintech-14160-1-ap","title":"Proteintech, 14160-1-AP, SLC25A45 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A45 (14160-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A45 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14160-1-AP targets SLC25A45 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  SH-SY5Y cells\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A45 (solute carrier family 25 member 45) is a mitochondrial inner membrane transporter recently identified as essential for the import of methylated amino acids. Dias et al. (2025, Molecular Cell) demonstrated that SLC25A45 specifically mediates the mitochondrial uptake of dimethylarginine and trimethyllysine, but not their unmethylated counterparts. This selective transport enables mitochondria to metabolize trimethyllysine for de novo carnitine biosynthesis, linking SLC25A45 activity to fatty acid oxidation and methylated amino acid homeostasis. A naturally occurring human variant, R285C, enhances SLC25A45 stability by disrupting m-AAA protease-dependent degradation and is associated with altered plasma levels of methylated amino acids and deoxycarnitine. Functionally, SLC25A45 defines a key metabolic node coordinating methylated amino acid turnover, carnitine synthesis, and mitochondrial signaling, implicating it in cardiovascular, renal, and metabolic pathophysiology. (PMID: 41075794)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5342 Product name: Recombinant human SLC25A45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-335 aa of BC041100 Sequence: DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGLCRHCFLGGSHALRRDQVPDADGWTETQSVPGDAGLHGEQHPAGRTGSLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPAAPHQAHGLEASLRLEARLKACKSVQEAQPFLTKVPPTRADLGWADTCGSRKPGACAASLCSWP Predict reactive species\nFull Name: solute carrier family 25, member 45\nCalculated Molecular Weight: 335 aa, 36 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC041100\nGene Symbol: SLC25A45\nGene ID (NCBI): 283130\nRRID: AB_2190339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N413\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805124777,"sku":"14160-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14160-1-ap","provider":"Iright","version":"1.0","type":"link"}